PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1016aa    MW: 110895 Da    PI: 5.4954
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599820.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29610661152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009599820.1 610 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 661
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53600681IPR003035RWP-RK domain
PfamPF020423.4E-26613661IPR003035RWP-RK domain
SuperFamilySSF542771.14E-209201006No hitNo description
PROSITE profilePS5174519.9359211003IPR000270PB1 domain
SMARTSM006666.1E-239211003IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.8E-229221002No hitNo description
CDDcd064079.80E-329221002No hitNo description
PfamPF005642.6E-169221002IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1016 aa     Download sequence    Send to blast
MSEPEEKITS KNPRPKSKEF SSPPPQQPPH TAMEKESTTM MMDLDIDASW SFDQIFAAAA  60
AVSSNPTSPF LPCSPLWGFS DDIEEKPAGN SFSGALRFSG HPRFGATYTD DPEATTETVS  120
VNADKGRLPS PVLELAPRDY PNGSCIIKER MTQALRYFKE STGERVLAQV WAPVKDAGRY  180
VLTTSGQPFV LDPDCNGLHQ YRTVSLMYMF AADGETGGVL GLPGRVFRLK LPEWTPNVQY  240
YSSKEFPRLD HALHYNVRGT LALPVFEPSG QSCLGVLELI MTSQKINYAA EVDKVCKALE  300
TVNLKSSEIL DHPNTQVYVM GYMNQICNEG RQNALVEILE ILTAVCETYQ LPLAQTWVPC  360
RHRSVLADGG GLKKSCSSFD GSCMGQICMS TTDVAFYVVD AHMWGFREAC AEHHLQKGQG  420
VAGRAYASQK SCFCEDITQF CKTEYPLVHY ARLFGLTSCF AICLRSSHTG NDDYILEFFL  480
PPNSGDYSDQ QALLNSLLLT MKQHFRSLSI ASGGELEHDW SSVEIIKASI EEKIDAKPES  540
VSAPKSLPQP TRLPNGWTHL DPLGEQQFSV ESDVAKGAGS KCGTGEAPNH VSPSDNKPTG  600
KKSERKRGKA EKTISLEVLQ QYFAGSLKDA AKSLGVCPTT MKRICRQHGI SRWPSRKINK  660
VNRSLSKLKC VIESVQGTEG AFTLTSLAPN SFPAAVGSIS WPACASGSNL PSSPLSKPSV  720
FPEEKNEFSN HGTPESHEEA EPSNQMLGGR VTRKEEFTPQ NGFLYAEGSH KSRTGSVSRE  780
ESAGTPTSQG SCQGSPSAGN EFSPQNDLVN SPAREACMKA GGSLEAAHQT TTENNLAAAF  840
LIPRPFIPER AQEPFGGMLV EDAGSSHDLR NLCSAGEAQV DERVPEYSLP NPPFSDAIAK  900
DPVYVPADTT PQYSAWPEVT FVTIKAAYRE DIIRFRLCLN SGIVKLKEEV AKRLKLELGT  960
FDIKYLDDDL EVVSISCDAD LQECVDISLS SGSSIVRLLV HDIMSNLGSS CESSGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599820.10.0PREDICTED: protein NLP6-like isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1A4Z40.0M1A4Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7